Tlc domain-containing protein

Author: dkts

August undefined, 2024

WebTRAM1 and TLC domain-containing protein (domain architecture ID 10551993) TRAM1 and TLC domain-containing protein. Graphical summary. Zoom to residue level. ... TLC domain; The actual alignment was detected with superfamily member smart00724: Pssm-ID: … WebTLCD1 → TLC domain-containing protein 1. Protein also known as : Calfacilitin . Gene name : TLCD1. Entry whose protein (s) existence is based on evidence at protein level. Show …

79850 - Gene ResultTLCD3A TLC domain containing 3A [ (human)]

WebZSWIM3蛋白抗体产品介绍：英文名称 Anti-ZSWIM3 中文名称 ZSWIM3蛋白抗体别名 Zinc finger SWIM domain containing protein 3; C20orf164; Zinc finger SWIM type containin WebDec 29, 2024 · Selenoprotein K (SELENOK) is a selenocysteine (Sec)-containing protein localized in the endoplasmic reticulum (ER) membrane where it interacts with the DHHC6 (where single letter symbols represent Asp-His-His-Cys amino acids) enzyme to promote protein acyl transferase (PAT) reactions. hydrocortisone 2.5% ointment tube sizes

TLCD1 - TLC domain-containing protein 1 - Function

WebTLCD5TLC domain containing 5 [ Homo sapiens(human) ] Gene ID: 219902, updated on 22-Sep-2024 Download Datasets Gene Sequences (FASTA) Transcript sequences (FASTA) … WebSep 1, 2002 · Structurally, the FLD-1 and TLCD1/2 proteins are characterized by the presence of a TLC domain and are therefore distantly related to the ER-localized ceramide synthases (human CERS1-6) and... WebOct 5, 2010 · Status. UniProtKB reviewed (Swiss-Prot) Organism. Homo sapiens (Human) Amino acids. 245. Protein existence. Evidence at transcript level. Annotation score. mass effect andromeda pre order bonus

Selenoprotein K Increases Efficiency of DHHC6 Catalyzed Protein ...

WebTRAM1 and TLC domain-containing protein. ... Description: Interval: E-value: TLC: smart00724: TRAM, LAG1 and CLN8 homology domains; Protein domain with at least 5 transmembrane ... 112-321: 6.19e-34: TRAM, LAG1 and CLN8 homology domains; Protein domain with at least 5 transmembrane alpha-helices. Lag1p and Lac1p are essential for … WebAug 1, 2002 · TLC domains could also act as lipid sensors, performing roles similar to, but distinct from, the multi-TM sterol-sensing domains of proteins such as the Niemann–Pick … mass effect andromeda promotional videoWebAug 7, 1998 · Thin-layer chromatography (TLC) is one of the simplest and most convenient techniques to separate small molecules. Of a variety of TLC separation modes, only size … mass effect andromeda project pretty

"WebThe TLDc domain-containing proteins could influence the expression of key oxygen free-radical scavengers that, in turn, reduce the levels of ROS in the cell [ (PUBMED:28707022) … " - Tlc domain-containing protein

Tlc domain-containing protein

TLCD5 TLC domain containing 5 [ Homo sapiens (human) ]

WebMar 9, 2015 · Sterile alpha motif and histidine-aspartate domain-containing protein 1 (SAMHD1) is a recently discovered enzyme that plays a central role in nucleotide metabolism and innate immunity. ... dGTP. Small portions (2 µL) were quenched at various times by direct spotting on a C18 reversed-phase TLC plate. The TLC plates were … WebProtein Domains Domain, Family, and Site Summary 1 - 2 of 2 Domain Details Per Protein 1 - 1 of 1 Transcripts Genome Browsers NCBI No data available Interactions and Pathways No data available Antibodies No data available Plasmids No data available Constructs No data available Marker Relationships 1 - 2 of 2 Show Sequences Overview ( 3)

Did you know?

Webbuilding phylogenetic trees of all of TLC domain-containing proteins, on which they formed a distinct branch. Due to the large number of non-Hox sequences, representative species were chosen to build the alignment and logos. SMART motif analysis (18) was performed on mouse Cers5. Analysis of the sequence of the last 12 residues of the Hox ... WebMar 21, 2024 · TLCD3A (TLC Domain Containing 3A) is a Protein Coding gene. Diseases associated with TLCD3A include Sclerosteosis 1 and Lung Cancer . An important paralog of this gene is TLCD3B. Additional gene information for TLCD3A Gene HGNC (29646) NCBI Entrez Gene (79850) Ensembl (ENSG00000167695) OMIM® (611627) UniProtKB/Swiss …

WebAug 6, 2024 · Analysis of Darwinian fitness, root and leaf ionome, and TEM images revealed that Pb-tolerant accessions employ two opposing strategies: (1) low translocation of Pb and its accumulation into root cell walls and vacuoles, or (2) high translocation of Pb and its efflux to inactive organelles or intracellular spaces. WebMar 21, 2024 · TLC domain-containing protein 1 Protein Accession: Q96CP7 Secondary Accessions: A8MYP9 Protein attributes for TLCD1 Gene Size: 247 amino acids Molecular …

WebGene: Tlcd4 (TLC domain containing 4) Rattus norvegicus Add Watcher Analyze General Array IDs Annotation Click to see Annotation Detail View Gene-Chemical Interaction Annotations Click to see Annotation Detail View Gene Ontology Annotations Click to see Annotation Detail View Biological Process Cellular Component Molecular Function … WebThe TLC (TRAM-LAG1-CLN8) domain is an about 200-residue domain found in a family of membrane-associated proteins related to yeast LAG1 and mammalian TRAM. It is …

WebSep 14, 2007 · First, TLC domain-containing proteins were identified using the Prosite domain data base ( 15 ). The entries were analyzed to determine which have a Hox domain. 32 proteins were selected for further analysis from a wide range of organisms. The Hox domains in most of these proteins were incomplete, with the N-terminal portion of the …

WebM02B1.3 TLC domain-containing protein [] Gene ID: 178236, updated on 22-Sep-2024 Summary Predicted to be involved in several processes, including membrane assembly; phospholipid homeostasis; and regulation of membrane lipid … hydrocortisone 5mg/5ml oral suspension bnfcWebTLC DOMAIN-CONTAINING PROTEIN 3B; TLCD3B Alternative titles; symbols FAMILY WITH SEQUENCE SIMILARITY 57, MEMBER B; FAM57B HGNC Approved Gene Symbol: TLCD3B … hydrocortisone 4% rectalWebDec 1, 2001 · TLC domain-containing protein 1 BLAST Add Sequence: RADPLRTWRWHNLLVSFAHSIVSGIWALLCVWQTPDMLVEIETAWSLSGYLLVCFSAGYFIHDTVDIVASGQTRASWEYLVHHVMAMGAFFSGIFWSSFVGGGVLTLLVEVSNIFLTIRMMMKISNAQDHLLYRVNKYVNLVMYFLFRLAPQAYLTHFFLRYVNQRTLGTFLLGILLMLDVMIIIYFSRLLRSDFCPEHVPKKQHKDKFLTE mass effect: andromeda ps4WebMar 1, 2003 · TLC domain-containing protein 4 Gene Tlcd4 Status UniProtKB reviewed (Swiss-Prot) Organism Mus musculus (Mouse) Amino acids 276 Protein existence … hydrocortisone 2mg/ml suspensionWebMar 21, 2024 · TLCD2 (TLC Domain Containing 2) is a Protein Coding gene. Diseases associated with TLCD2 include Chromosome 17P13.3, Centromeric, Duplication … hydrocortisone 2.5% on faceWebJan 1, 2012 · Phylogenetic analysis reveals that the Hox-like domain-containing family members divide into two distinct branches, CerS2, -3, and -4 and CerS5 and -6 ( Fig. 1A ), with the former using mainly very long chain acyl-CoAs (C18–26) and the latter using long chain (C14–16) CoAs. mass effect andromeda psnWebSummary Gene: Tlcd4 (TLC domain containing 4) Mus musculus Add Watcher Analyze General Array IDs Annotation Click to see Annotation Detail View Gene-Chemical Interaction Annotations Click to see Annotation Detail View Gene Ontology Annotations Click to see Annotation Detail View Biological Process lipid homeostasis (IBA) Cellular Component mass effect andromeda rated in australia